PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010110355.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HB-other
Protein Properties Length: 347aa    MW: 39599.3 Da    PI: 4.4903
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010110355.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.79.5e-09280327653
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     +++k  l++Le+++++++ p+ +++  + + ++L+ +++  WF  +R 
  XP_010110355.1 280 RLKKAHLQTLEDVYRRTKRPTNAMISSIVHVTNLPRKRIVKWFEDKRS 327
                     678999***************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.523272332IPR001356Homeobox domain
SuperFamilySSF466891.58E-8278336IPR009057Homeodomain-like
CDDcd000863.91E-6278326No hitNo description
SMARTSM003893.3E-4278336IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-7279329IPR009057Homeodomain-like
PfamPF000462.8E-6280327IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGLASALNAP SIGLQWAACP GGEPVLLGRR PAHLVLPPQR IPSRSASTLV FSRRRNRNSA  60
ITSPRKNNKL QKLGRNGGLE EEEEEIDDDA FEALFRQLEE DLKKDDPSLF DGDDDDEDIS  120
EEDLAKLDEQ IAEVFDMTGY DIDEEDEVIE MEEEDEDEDE DGDEEKEEEE EEEQPVTLKN  180
WQLRRLASAL KIGRRKTNIK SLAAELCLDR PVVLELLRNP PPNLLMMSAA LPDHEPPPTI  240
TVTEVKTIET VVEKTTTPKS DTAEKVPVHV MQQRFSNQKR LKKAHLQTLE DVYRRTKRPT  300
NAMISSIVHV TNLPRKRIVK WFEDKRSEEG VPDQRIPYQR SVHNTVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010110355.10.0hypothetical protein L484_005624
SwissprotQ8H0V59e-75OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLW9SFM30.0W9SFM3_9R
STRINGVIT_04s0008g05190.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101813138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.12e-52overexpressor of cationic peroxidase 3